Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Jessie Huang
    Tel: +86-755-26659310

  • Ms.Yang
    Tel: 86-755-26659310

  • Ms.Eva Chen
    International market manager
    Tel: 8675526659310-805

  • Ms.Sisi
    Tel: +86-755-26659310

  • Mobile:18025382833
  • Tel:+86-755-26659310
  • Fax:
  • URL:http://www.szreadline.com
  • Province/state:Guangdong
  • City:Shenzhen
  • Street:A-3rd Floor, Wanhe Medical Park, No. 8, Gaoxin C.1st Ave, Nanshan District, Shenzhen, Guangdong, China.
  • MaxCard:
Home > Products >  Exenatide Acetate

Exenatide Acetate CAS NO.141758-74-9

  • Min.Order: 0
  • Payment Terms:
  • Product Details

Keywords

  • Exenatide, AC 2993, Exendin A, ExendinA
  • exendin-4
  • HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Quick Details

  • ProName: Exenatide Acetate
  • CasNo: 141758-74-9
  • Molecular Formula: C184H282N50O60S
  • Appearance: White to Off-white powder
  • Application: Endocrine system peptides
  • DeliveryTime: within 5-7 working days after receivin...
  • PackAge: As clients demand
  • Port: Shanghai/Shenzhen/Hongkong/Guangzhou
  • Purity: ≥98.0%
  • Storage: 2-8℃
  • Transportation: by sea/by express/by air
  • LimitNum: 0

Superiority

1. High quality standards with competitive prices.
2. Stable supply of protected amino acids for over 20 years.
3. Management according to the GMP concept.
4. Conforming to the requirements of ICHQ12
5. 100% non-animal source, heavy metal residue detection as clients require.
6. The quality control index of products ≥ 20 items.
7. A 2-8℃ cold storage of 100 square meters, which will be expanded to 300 square meters in the future.

Details

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog