- Product Details
Keywords
- Exenatide, AC 2993, Exendin A, ExendinA
- exendin-4
- HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Quick Details
- ProName: Exenatide Acetate
- CasNo: 141758-74-9
- Molecular Formula: C184H282N50O60S
- Appearance: White to Off-white powder
- Application: Endocrine system peptides
- DeliveryTime: within 5-7 working days after receivin...
- PackAge: As clients demand
- Port: Shanghai/Shenzhen/Hongkong/Guangzhou
- Purity: ≥98.0%
- Storage: 2-8℃
- Transportation: by sea/by express/by air
- LimitNum: 0
Superiority
1. High quality standards with competitive prices.
2. Stable supply of protected amino acids for over 20 years.
3. Management according to the GMP concept.
4. Conforming to the requirements of ICHQ12
5. 100% non-animal source, heavy metal residue detection as clients require.
6. The quality control index of products ≥ 20 items.
7. A 2-8℃ cold storage of 100 square meters, which will be expanded to 300 square meters in the future.